Eukaryotic Cell, February 2008, p. 202-211, Vol. 7, No. 2
1535-9778/08/$08.00+0 doi:10.1128/EC.00292-07
Copyright © 2008, American Society for Microbiology. All Rights Reserved.
Excystation of Eimeria tenella Sporozoites Impaired by Antibody Recognizing Gametocyte/Oocyst Antigens GAM22 and GAM56
Jürgen Krücken,1*
Ralf J. Hosse,1
Aimdip N. Mouafo,2
Rolf Entzeroth,2
Stefan Bierbaum,1
Predrag Marinovski,1
Karolina Hain,1
Gisela Greif,3 and
Frank Wunderlich1
Division of Molecular Parasitology and Biological and Medical Research Centre, Heinrich-Heine-University, Düsseldorf,1
Institute of Zoology, TU-Dresden, Dresden,2
Animal Health Business Group, Research & Development, Bayer AG, Monheim, Germany3
Received 10 August 2007/
Accepted 14 November 2007
 |
ABSTRACT
|
|---|
Eimeria tenella is the causative agent of coccidiosis in poultry. Infection of the chicken intestine begins with ingestion of sporulated oocysts releasing sporocysts, which in turn release invasive sporozoites. The monoclonal antibody E2E5 recognizes wall-forming body type II (WFBII) in gametocytes and the WFBII-derived inner wall of oocysts. Here we describe that this antibody also binds to the stieda body of sporocysts and significantly impairs in vitro excystation of sporozoites. Using affinity chromatography and protein sequence analysis, E2E5 is shown to recognize EtGAM56, the E. tenella ortholog of the Eimeria maxima gametocyte-specific GAM56 protein. In addition, this antibody was used to screen a genomic phage display library presenting E. tenella antigens as fusion proteins with the gene VIII product on the surfaces of phagemid particles and identified the novel 22-kDa histidine- and proline-rich protein EtGAM22. The Etgam22 mRNA is expressed predominantly at the gametocyte stage, as detected by Northern blotting. Southern blot analysis in combination with data from the E. tenella genome project revealed that Etgam22 is an intronless multicopy gene, with approximately 12 to 22 copies in head-to-tail arrangement. Conspicuously, Etgam56 is also intronless and is localized adjacent to another gam56-like gene, Etgam59. Our data suggest that amplification is common for genes encoding oocyst wall proteins.
 |
INTRODUCTION
|
|---|
Coccidiosis in poultry is caused by protozoan parasites of the genus Eimeria. Worldwide economic losses due to these parasites have been estimated to exceed 1.2 billion U.S. dollars per annum (41). The most virulent species is Eimeria tenella, causing severe hemorrhagic enteritis by infection of the epithelium and submucosa of the ceca and, eventually, death of infected chickens (24).
Eimeria infections occur by ingestion of oocysts (24). In the intestine, oocysts release four sporocysts, each containing two sporozoites. After excystation, motile infective sporozoites actively enter cells in the epithelium of the cecum. Three rounds of asexual multiplication in the epithelium and submucosa are then followed by differentiation to sexual stages of micro- and macrogametocytes (23). After fertilization of macrogametes, a complex, two-layered wall is secreted around the young oocyst by exocytosis of wall-forming body type I and type II (WFBI and WFBII) (35). While the 10-nm-thick outer oocyst wall is built up by the contents of WFBI, the 90-nm inner oocyst wall is composed mainly of glycoproteins that were stored in WFBII (31, 37). The oocyst displays a remarkable rigidity and protects the parasite from several physically and chemically adverse influences, such as commonly used disinfectants (34). A potential use of gametocyte antigens involved in formation of the oocyst wall as protective transmission-blocking vaccines has been described for Eimeria maxima (2, 4, 25, 38-40, 46).
The formation of oocyst and sporocyst walls and sporozoite excystation are rather complex processes that we are just beginning to understand. Only a few WFBII-localized glycoproteins have been characterized for E. tenella (10) and for E. maxima. They have been shown to undergo site-specific proteolysis before incorporation into the mature oocyst wall (1, 3, 4, 5). Moreover, there is compelling evidence for the occurrence of cross-linking of these tyrosine-rich proteins. This process of sclerotization involves the formation of dityrosine bonds as well as the emergence of covalent bonds between proteins by peroxidase-mediated mechanisms involving L-3,4-dihydroxyphenylalanine (DOPA). Incidentally, sclerotization of the oocyst wall appears to be comparable to other hardening processes in extracellular matrices, such as insect and nematode cuticles, yeast cell walls, mussel byssal threads, and sea urchin fertilization membranes (3).
In E. tenella, the WFBII of macrogametocytes and the inner oocyst wall can be labeled specifically by the monoclonal antibody E2E5 (26). This antibody recognizes a complex, developmentally regulated pattern of protein bands in Western blot analysis (26). Here we show that E2E5 recognizes proteins encoded by at least two different genes and impairs sporozoite excystation.
 |
MATERIALS AND METHODS
|
|---|
Animals, parasites, and infections.
The strain E. tenella VT-2 was used throughout all experiments. Male chickens of Leghorn type strain LSL (Josef Brinkschulte GmbH, Senden, Germany) were infected with 15,000 oocysts. For preparation of oocysts, infected chickens were killed, and the contents of the cecum were flushed out with 2% potassium dichromate solution. Sporulation of oocysts was completed after they were stirred in 2% potassium dichromate at 28°C for 48 h.
Cell culture.
The hybridoma cell lines E1D8 and E2E5 were previously described to specifically recognize antigens in WFBI and WFBII, respectively (26). Hybridomas and the human T-cell lymphoma cell line Jurkat were cultivated in RPMI 1640 supplemented with 10% fetal calf serum at 37°C, 5% CO2, and 100% humidity. For most experiments, supernatants were concentrated 50-fold using Vivaspin concentrators (Sartorius AG, Göttingen, Germany) with a 100-kDa cutoff.
Immunofluorescence.
Reactivity of E2E5 to intracellular E. tenella stages was analyzed as described previously (26). Briefly, semithin sections of LR-White-embedded ceca from E. tenella-infected chickens were probed with undiluted hybridoma culture supernatants before detection with fluorescein isothiocyanate (FITC)-coupled anti-mouse immunoglobulin G (IgG) (for E2E5) or rhodamine-coupled anti-mouse immunoglobulin M (IgM) (for E1D8) antibody (Sigma, Germany). Sections were examined using a Zeiss Axioscop 2 microscope.
Oocysts were vortexed in the presence of glass beads until rupturing of most walls of oocysts and sporocysts. After centrifugation, the pellet was resuspended in methanol (–20°C), incubated for 10 min at –20°C, washed in phosphate-buffered saline (PBS), and subjected to immunofluorescence microscopy as described recently (18). Oocysts and sporocysts were treated with 0.1% Triton X-100 in PBS for 10 min, blocked for 1 h in PBS-1% bovine serum albumin (BSA), incubated with a 1:40 dilution of concentrated E2E5 supernatant for 2 h, and finally visualized with a 1:100 dilution of a secondary goat anti-mouse antibody coupled to Alexa Fluor 488 (Molecular Probes, Karlsruhe, Germany).
Excystation assay.
Freshly sporulated oocysts were ruptured in a glass Teflon potter. Free sporocysts were incubated overnight at 4°C in PBS containing 10 µg/ml enrofloxacin (Baytril; Bayer, Leverkusen, Germany). Sporocysts were then collected by centrifugation and resuspended in 20 ml PBS containing 2.5 µg/ml trypsin before adding 1 ml of chicken bile. Aliquots of 250 µl were incubated in the presence of either 12.5 µl E2E5 concentrated 50-fold or control supernatants at 41.5°C and 5% CO2 for 5 h. Numbers of sporocysts before excystation and of free sporozoites after excystation were counted in a Neubauer chamber. Statistical comparisons between groups were done using paired Student's t test.
Affinity chromatography and Edman degradation.
E. tenella gametocytes were purified as described recently (26). Proteins were solubilized with 0.5% Triton X-100-PBS containing 1 mM phenylmethylsulfonyl fluoride. Columns containing 4 ml protein A-Sepharose CL-4B covalently cross-linked to E2E5 (Amersham Biosciences, Freiburg, Germany) were loaded with detergent-solubilized gametocytes at a flow rate of 0.5 ml/min at 4°C. Unbound material was washed off with 100 ml PBS supplemented with 1 M NaCl, 0.5% Triton X-100, and 1 mM EDTA. Elution of antigen was performed with 0.1 M diethylamine (pH 11.5) and 0.1% Triton X-100. Fractions of 1 ml were immediately neutralized with 200 µl Tris-Cl (pH 7.5) and then dialyzed against 0.1 mM Tris-Cl (pH 6.8) before being lyophilized. The purified 51-kDa protein was separated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE). Gels were either silver stained or transferred to polyvinylidene difluoride membranes (Millipore, Schwalbach, Germany). The sequence of the NH2 terminus of the protein was determined using Edman degradation at the University of Gent (Belgium).
Construction of phage display library.
Genomic DNA was isolated from oocysts according to the method of Blin and Stafford (7). Sheared DNA (150 bp to 800 bp) was ligated into SnaBI-digested pG8SAET (45) and transformed into electrocompetent Escherichia coli TG1 cells (Stratagene, Heidelberg, Germany). Clones from several transformations were pooled to obtain a final library with 4.7 x 106 independent clones (
95% recombinant clones). Phagemids were prepared using the helper phage R408 (Promega, Heidelberg, Germany).
Screening of phage display library.
In order to identify phage clones expressing fusion proteins reacting with E2E5, the latter was immobilized on magnetic pan-mouse IgG Dynabeads (Invitrogen) according to the manufacturer's instructions. All incubations containing Dynabeads were carried out at 4°C with rotation. After being blocked with PBS-0.1% BSA, beads were collected using a Dynal MPC-S magnet (Deutsche Dynal GmbH). For every screening round, two parallel binding reaction mixtures containing 2 x 107 control or E2E5-coupled beads and 200 µl phagemids in a final volume of 400 µl PBS-0.1% BSA were set up. After overnight binding, beads were washed 10 times for 5 min each with 2 ml PBS-0.1% BSA and once for 15 min with 150 mM NaCl-50 mM sodium citrate (pH 4.5) before phagemids were eluted with 400 µl 150 mM NaCl-50 mM sodium citrate (pH 1.8). After neutralization with 40 µl 2 M Tris-Cl (pH 8.6), the phagemids were used to reinfect E. coli TG1 cells, titrated, and amplified before use in consecutive screening rounds.
RNA and protein isolation.
For reverse transcription-PCR (RT-PCR), DNA-free total RNAs from ruptured oocysts and chicken ceca were isolated using an Invisorb RNA kit II (Invitek, Berlin, Germany). For Northern blot analysis, RNAs were isolated from ceca and oocysts by using Trizol (Invitrogen). Subsequently, proteins were extracted from the same samples for Western blotting.
Western blotting.
Protein extracts from E. coli TG1 overnight cultures were separated by SDS-PAGE, according to the method of Laemmli (20), and then transferred to membranes. A 1:200 dilution of concentrated E2E5 hybridoma supernatant in 1x RotiBlock (Roth, Karlsruhe, Germany) was used as the primary antibody. For detection, a 1:4,000 dilution of goat anti-mouse IgG coupled to horseradish peroxidase (Jackson ImmunoResearch Laboratories, Cambridge, United Kingdom) was combined with an ECL detection system (Amersham Biosciences, Freiburg, Germany). For analysis of protein expression in E. tenella, proteins were isolated from infected ceca or oocysts by using Trizol (Invitrogen). Sixty-microgram samples from ceca or 20-µg samples from oocysts were separated by 9 to 15% gradient SDS-PAGE, transferred to a nitrocellulose membrane, and developed as described above.
Sequence analyses.
DNA sequencing was performed as described previously (19), using a LI-COR 4000 automatic DNA sequencer. All nucleic acid and deduced protein sequences were compared to the GenBank and E. tenella genome project databases by using BLAST algorithms. Protein sequences were analyzed using the InterProScan server (44). NH2-terminal signal peptides were identified using SignalP 3.0 (6), and glycosylation site prediction was performed with NetOGlyc 3.1 (13). The genomic sequence data for Eimeria tenella were produced by the Eimeria Sequencing Group at the Sanger Institute and can be obtained online (ftp://ftp.sanger.ac.uk/pub/pathogens/Eimeria/tenella/). For Toxoplasma gondii, preliminary cDNA sequence data were accessed via http://ToxoDB.org. Genomic data were provided by The Institute for Genomic Research and by the Sanger Center (Wellcome Trust). Expressed sequence tag sequences were generated by Washington University.
Cloning of full-length Etgam22 cDNA.
Rapid amplification of cDNA ends (RACE) was carried out with RNA from sporulated oocysts as a template, using a 5'-3'-RACE kit (Roche, Mannheim, Germany). For 3'-RACE, cDNA was synthesized from 2 µg total RNA, using an oligo(dT) anchor primer. PCR mixtures contained 1 µl of cDNA, 10 µl Q solution (Qiagen, Hilden, Germany), a 0.4 mM concentration of each deoxynucleoside triphosphate (dNTP), 0.25 µM of the PCR anchor primer, the primer 5'-TGAGGACTATCCTAGCCACCCTAGTCGGTTTC-3', and 5 U Expand high-fidelity DNA polymerase (Roche, Mannheim, Germany) in 50 µl high-fidelity buffer. The enzyme was added during the first annealing phase to achieve a hot start.
Synthesis of cDNA for 5'-RACE was started with the Etgam22-specific primer 5'-AGGATGCGCAAAATGGTAGTCATGGTGATAAT-3'. The cDNA was purified and tailed with dATP, using terminal nucleotide transferase. PCR was carried out with 5 µl purified cDNA as the template, as described for 3'-RACE, using the PCR anchor primer and the primer 5'-TATGTTCATGATGATGATGGTGAGGATGATGG-3' for the first round, with the primer 5'-GTGGGGATGATGGTCGGG-3' used for nested PCR. All PCRs were carried out with the same cycling parameters. After 2 min of denaturation at 94°C, 35 cycles of 15 s at 94°C, 30 s at 63°C, and 4 min at 72°C were executed, with a final extension for 10 min at 72°C. PCR products were cloned into the pCR2.1 TOPO vector (Invitrogen, Karlsruhe, Germany).
Southern blotting.
Genomic DNAs were isolated from sporozoites by using an Invisorb genomic DNA kit II. Southern blots were carried out as detailed previously (18). Briefly, 10 µg genomic DNA was digested with the indicated restriction enzymes, separated in 0.7% agarose gels, and transferred to Hybond-N nylon membranes (Amersham). Hybridization was performed using the full-length Etgam22 cDNA as a probe. For estimation of the Etgam22 copy number, the Etgam22 cDNA in plasmid pcDNA3.1 was linearized with XhoI, and defined amounts of linearized plasmid and DraI-digested genomic DNA were mixed before analysis of twofold serial dilutions of the mixture by Southern blotting. Blots were exposed to Kodak Biomax MS film with an intensifying screen at –80°C or to a Fuji BAS-MS imaging plate and were read with a Fuji BAS-1500 phosphorimager. Densitometric analysis was performed with QuantiScan 1.5 (Biosoft, Cambridge, United Kingdom). Signal intensities from the plasmid DNA were plotted against the copy number, and the copy number of genomic DNA was calculated by assuming a haploid genome size of 60 Mb.
RT-PCR.
RNA (3.5 µg) was reverse transcribed in 50 µl 1x avian myeloblastosis virus (AMV) buffer containing a 0.4 mM concentration of each dNTP, 5 mM dithiothreitol, 2.5 µM random hexamer primers, 50 U AMV reverse transcriptase (all from Roche, Mannheim, Germany), and 80 U RNasin (Promega, Heidelberg, Germany). Reaction mixtures were incubated at 22°C for 10 min, at 42°C for 30 min, and at 55°C for 30 min before inactivation of the enzyme by heating at 95°C for 5 min. As negative controls, parallel reaction mixtures were incubated without AMV reverse transcriptase or without RNA. PCR mixtures contained 5 µl of the RT products, a 0.4 mM concentration of each dNTP, 0.4 µM of each primer, 10 µl Q solution (Qiagen, Hilden, Germany), and 5 U Expand high-fidelity DNA polymerase (Roche, Mannheim, Germany) in 50 µl 1x high-fidelity buffer. Primers for amplification of Etgam22 were 5'-TCCTCATCCTTATCATCCTCATCCT-3' and 5'-GTGGGGATGATGGTCGGG-3'. Control PCRs amplifying an actin fragment used the primers 5'-CTGTGAGAAGAACCGGGTGCTCTTC-3' and 5'-CGTGCGAAAATGCCGGACGAAGAG-3'. The reaction mixtures were denatured for 2 min at 94°C, followed by 35 cycles of 15 s at 94°C, 30 s at 63°C, and 1 min at 72°C. A final extension for 10 min at 72°C completed the reactions.
Amplification of full-length Etgam22 cDNA was carried out with 5 µl cDNA from infected ceca at 137 h postinfection (p.i.). Reactions were performed as described above, using the primers 5'-CAGGACCCCAAAATAAAATCAAAGGCTATCACA-3' and 5'-TGACCGGTGGTGTGTACTTCGTAAC-3'.
Northern blotting.
RNAs (20 µg) were glyoxylated, separated in agarose gels, transferred to Hybond-N membranes (Amersham), and hybridized as described recently (42).
In vitro translation.
Coupled in vitro transcription and translation were performed using the TnT quick coupled transcription/translation system (Promega). In vitro translation products were separated by SDS-PAGE and subjected to Western blotting using the E2E5 antibody.
Nucleotide sequence accession number.
The nucleotide sequence data reported in this paper appear in the DDBJ, EMBL, and GenBank nucleotide sequence databases under accession number CS000361.
 |
RESULTS
|
|---|
In vitro inhibition of excystation.
The monoclonal antibody E2E5 recognized antigens in the WFBII of gametocytes and in the inner oocyst wall of E. tenella (Fig. 1A to C), thus confirming our previous results (26). In addition, we show here that E2E5 reacts with the apical stieda body in ruptured but not intact sporocysts (Fig. 1D). This indicates that the epitope is not accessible for the E2E5 antibody from the outside.

View larger version (37K):
[in this window]
[in a new window]
|
FIG. 1. Functional characterization of antigens recognized by E2E5. (A and B) Semithin sections of ceca from infected chickens. (A) Macrogamonts were labeled with E2E5 and an anti-mouse IgG antibody coupled to FITC. (B) The same parasites are shown by bright-field microscopy. (C) Localization of E2E5-reactive antigens at the inner oocyst wall (black arrowhead) is shown by double labeling with E2E5 and anti-mouse IgG-FITC and then with E1D8 and anti-mouse IgM-rhodamine. E1D8 recognizes the outer oocyst wall (white arrowhead). (D) Localization of E2E5-binding structures in sporocysts. Oocysts were mechanically ruptured with glass beads before being labeled with E2E5 and a goat anti-mouse Alexa 488-coupled secondary antibody. The arrow indicates the position of the stieda body. The arrowhead marks a small rupture of the wall in the sporocyst. Separate phase-contrast and green fluorescence pictures were taken and merged using Corel Photo-Paint 10. Bars, 10 µm. (E) Inhibition of in vitro excystation by the monoclonal antibody E2E5. In vitro excystation was performed in the presence of 50-fold-concentrated E2E5 or control supernatant derived from the hybridoma E1D8 or from Jurkat cells. As an isotype control, concentrated Jurkat cell supernatant was supplemented with 250 µg/ml anti-V5 IgG2a antibody (Invitrogen). Excystation efficiencies, evaluated as the number of released sporozoites per total number of sporozoites contained in sporocysts, were calculated and normalized to the mean excystation efficiency of the control. *, P < 0.05 (versus E2E5 supernatant); **, P < 0.01 (versus E2E5 supernatant).
|
|
Since the apical stieda body of sporocysts is involved in the excystation process of sporozoites, we also tried to inhibit in vitro excystation of E. tenella sporozoites from the sporocysts with E2E5. The oocyst walls were mechanically disrupted, and excystation was induced by incubation of free sporocysts with trypsin and bile at 41.5°C for 5 h. In these control experiments, between 48% and 77% of all possibly available sporozoites were released from sporocysts. The addition of supernatants from E2E5 significantly decreased the release of sporozoites, by about 50% (Fig. 1E). In contrast, neither supernatants from E1D8 hybridoma cells nor supernatants from Jurkat cells, with or without supplementation with an irrelevant IgG2a antibody (anti-V5 tag), had any significant effect on excystation.
E2E5 recognizes a complex pattern of proteins in the different developmental stages of E. tenella (23). In order to identify genes encoding the corresponding proteins, we used two complementary approaches. First, we characterized the largest of the proteins by affinity chromatography and Edman degradation. Secondly, we used phage display to select cDNAs encoding proteins recognized by E2E5.
Purification and identification of EtGAM56 from gametocytes.
Young gametocytes express only a single protein, of about 51 kDa, that is recognized by E2E5. Affinity chromatography was performed with E2E5 coupled to protein A agarose. The protein fraction eluted from the column was separated by SDS-PAGE and either silver stained (Fig. 2) or blotted on a polyvinylidene difluoride membrane for protein sequencing. Edman degradation of the NH2 terminus resulted in the sequence VPTTVENTVHPYSEMGHYQEGRPYAAYMG. Database screening using this sequence revealed a 78% identity of amino acids 3 to 21 of this sequence to the GAM56 protein of Eimeria maxima (EmGAM56) (1, 5). Moreover, 20 of the first 21 amino acids in this sequence can be deduced from the sequence of a genomic contig deposited in the E. tenella database. An intronless open reading frame of 374 amino acids encoding a 54-kDa protein can be deduced from the corresponding region of the genomic sequence dev_EIMER_contig_00030093-eimer-679b04.p1ka (data not shown). This putative protein has 63% identity and 73% similarity to EmGAM56, as revealed by BLAST analysis. Since both EmGAM56 and the 54-kDa protein recognized by E2E5 are expressed selectively in the macrogametocyte stage and antibodies to EmGAM56 also selectively recognize WFBII, we propose that the 54-kDa protein is the E. tenella ortholog to GAM56 of E. maxima and should be designated EtGAM56.

View larger version (60K):
[in this window]
[in a new window]
|
FIG. 2. Purification of 51-kDa antigen by affinity chromatography. Protein extracts from purified gametocytes (lane 1) and proteins eluted from the E2E5 affinity column (lane 2) were separated by SDS-PAGE and silver stained. Positions of molecular size marker bands are indicated.
|
|
Interestingly, a second GAM56-like protein, of 59 kDa, is encoded on the same contig and in the same orientation, about 2.3 kb upstream of Etgam56. We designate this intronless gene Etgam59, although we have not shown gametocyte-specific expression of Etgam59 yet. Figure 3 shows a multiple sequence alignment of both deduced E. tenella proteins with the GAM56 sequence of E. maxima. The sequences of all three GAM56-like proteins are rich in the amino acids Ala, Pro, Thr, and Ser. Moreover, all of these proteins contain a Tyr-rich domain. EmGAM56 is known to be present in the WFBII, the inner oocyst wall, and the apical part of the sporocyst, and this fits perfectly well to our data from immunofluorescence and immunoelectron microscopy presented in Fig. 1 and to the data of Mouafo et al. (26). Remarkably, EmGAM56 has been shown to be proteolytically cleaved during oocyst formation into mature polypeptides of 33 kDa and 12 kDa (3). Indeed, the protein band corresponding to EtGAM56 disappears in unsporulated oocysts, and a strong band of slightly larger than 30 kDa appears (26).

View larger version (62K):
[in this window]
[in a new window]
|
FIG. 3. Sequence alignment of GAM56-like proteins from E. tenella and E. maxima. Amino acids showing identity to the sequence obtained from Edman sequencing of the NH2 terminus are highlighted in gray. Invariable amino acid positions are marked with asterisks, and substitutions rated conservative and semiconservative by ClustalW using the GONNET 250 matrix are marked with colons and periods, respectively.
|
|
Cloning of EtGAM22 by phage display.
In addition to EtGAM56 and its 33-kDa proteolytic fragment, E2E5 recognizes two smaller proteins, of approximately 23 kDa and 25 kDa, in unsporulated oocysts and an approximately 80-kDa protein in sporulated oocysts (26). In order to identify additional proteins recognized by E2E5, a genomic phage display library presenting recombinant E. tenella proteins as fusions with the gene VIII product of filamentous phage on the surfaces of phagemid particles was constructed. After four rounds of library panning against E2E5 coupled to Dynabeads, enrichment of a clone containing an insert of 145 bp was observed (data not shown). Western blot analysis clearly revealed that this phage clone, clone A17, expresses a recombinant gene VIII product fusion protein that is recognized by E2E5, while other clones were consistently negative (Fig. 4).

View larger version (40K):
[in this window]
[in a new window]
|
FIG. 4. Identification of E2E5-binding phagemid clones by Western blotting. Protein lysates of bacterial cultures were separated by SDS-PAGE. As a positive control (Pos), a protein extract from an E. tenella-infected cecum at 137 h p.i. was used. The negative control (Neg) consisted of a bacterial culture containing the empty pG8SAET phagemid vector.
|
|
Using 5'- and 3'-RACE PCR, we cloned the complete open reading frame of the corresponding mRNA. Figure 5 shows the cDNA sequence of Etgam22 and the deduced protein sequence. The EtGAM22 protein has a length of 198 amino acids, a molecular mass of 22.8 kDa, and a predicted pI of 6.8. At the NH2 terminus, a signal peptide for cotranslational transport into the endoplasmic reticulum (ER) is predicted by the SignalP 3.0 program (6). The amino acid composition of the mature EtGAM22 protein without a signal peptide is very unusual, since only four amino acids, His (25.7%), Pro (19%), Gln (8.4%), and Ala (6.1%), account for nearly 60% of all residues. In particular, an extremely His- and Pro-rich domain between Pro73 and His188 can be identified. This partially resembles the case for EmGAM56, which contains 12.8% Pro and 8% Ala residues. In contrast to EtGAM22, however, EmGAM56 contains only 0.6% His and 2.9% Gln residues, whereas EtGAM22 contains no Tyr-rich domain characteristic of other gametocyte-specific proteins, such as EmGAM56 and EmGAM82 (3). The sequence of the original phage clone A17 containing the E2E5 epitope is completely localized within this His/Pro-rich domain. Moreover, there are putative O glycosylation sites at Thr74, Thr80, and Thr81, as predicted by NetOGlyc 3.1.

View larger version (70K):
[in this window]
[in a new window]
|
FIG. 5. cDNA and deduced protein sequences of EtGAM22. The NH2-terminal signal peptide is shaded in light gray, and the sequence corresponding to the original phage display clone is shaded in dark gray.
|
|
Genomic organization of EtGAM22.
BLAST analysis of the sequences deposited by the E. tenella genome project identified several perfect matches showing that the Etgam22 gene—like Emgam56, Etgam56, and Etgam59—does not contain any introns. Conspicuously, there are two contigs (dev_EIMER_contig_00030727-eimerbac28g8Fb07.q1k [data not shown] and dev_EIMER_contig_00016586-eimer-437a12.q1k) with two identical head-to-tail repeats of the Etgam22 gene. One of these contigs is drawn schematically in Fig. 6A. In addition, the intergenic regions between the copies are also nearly perfectly conserved (99% identity), indicating that the promoter regions are virtually identical. In order to demonstrate that Etgam22 is indeed a multicopy gene, we performed genomic Southern blot analysis using six different restriction enzymes (Fig. 6B). With the exception of DraI, all enzymes produced one intensive band and one or two faint bands, which is in accordance with several virtually identical head-to-tail copies of Etgam22. In particular, it should be mentioned that the restriction sites for all the enzymes used here are located outside the Etgam22 open reading frame, indicating a high degree of conservation even in the noncoding sequences of the cluster. The faint bands represent unique fragments from the end of the Etgam22 cluster. We used two complementary approaches to estimate the Etgam22 copy number in the E. tenella genome. The genomic DNA digested with BglI and MvaI (Fig. 6B) yielded two bands, i.e., a faint band representing a single copy located at the end of the Etgam22 cluster and a strong band due to hybridization to the other members of the cluster. After correction for different overlaps of internal and flanking Etgam22 copies with the hybridization probe, it should be possible to calculate the copy number from the ratio of band intensities. Our results indicate that there are 14 times more hybridization targets in the strong than in the faint BglI band and 11 times more targets in the strong than in the faint MvaI band. Therefore, we assume that there are between 12 and 15 copies of Etgam22 in the genome.

View larger version (29K):
[in this window]
[in a new window]
|
FIG. 6. Genomic organization of Etgam22. (A) Schematic drawing showing one end of the sequence contig 2257242.c007101021.contig1, containing two copies of the Etgam22 open reading frame (Etgam22). Some of the predicted restriction fragments rely on the assumption that at least one additional copy of Etgam22 can be found further upstream (indicated in light gray on the left). (B) Genomic Southern blot using the enzymes BglI (lane 1), ClaI (lane 2), KpnI (lane 3), AccI (lane 4), DraI (lane 5), and MvaI (lane 6). The blot was hybridized with the Etgam22 cDNA probe indicated in panel A. (C) Southern blot containing serial dilutions of genomic DNA from E. tenella digested with DraI and Etgam22 cDNA in pcDNA3.1 linearized with XhoI. The lanes (from left to right) contained 1.7 µg (25,856,313 copies, assuming a genome size of 60 Mbp), 0.85 µg, 0.425 µg, 0.213 µg, 0.106 µg, 0.053 µg, and 0.027 µg of genomic DNA and 726 pg (100,000 copies), 363 pg, 181.5 pg, 90.7 pg, 45.4 pg, 22.7 pg, and 11.3 pg of plasmid DNA. The 6,629-bp band corresponds to the plasmid DNA, while the 995-bp band was shown in panel B to result from binding of the probe to DraI-digested genomic DNA.
|
|
For an independent approach to estimate the copy number of Etgam22, we used the single band produced in Southern blots after digestion with DraI. Genomic DNA from E. tenella was digested with DraI and mixed with XhoI-restricted Etgam22 in the plasmid vector pcDNA3.1 (6,629 bp). Twofold serial dilutions of this mixture were analyzed by Southern hybridization (Fig. 6C). After densitometric evaluation of band intensities, the optical densities of the plasmid bands were evaluated using a phosphorimager and then plotted against the copy number per lane. Using this standard curve, the number of Etgam22 copies in genomic DNA per lane was calculated from the band intensities for genomic DNA. Finally, the Etgam22 copy number per genome was calculated to be 19 ± 3, assuming a genome size of 60 Mbp and using only those genomic DNA bands with intensities within the range of the standard curve. Presumably, this is a more accurate value since the limited linear range of X-ray film compared to that of a phosphorimager may lead to underestimation of strong band intensities.
Gametocyte-specific expression of EtGAM22.
RT-PCR analysis showed that the Etgam22 mRNA is not expressed in the early stage of infection, at 72 h p.i., whereas it is readily detectable at 137 h p.i. and 148 h p.i. and in sporulated oocysts (Fig. 7A). However, expression levels in these stages differ widely, as revealed by Northern blot analysis (Fig. 7B). Thus, Etgam22 was not detectable in sporulated oocysts, while a faint hybridization signal was obtained from RNAs of gametocytes at 138 h p.i. Expression of Etgam22 mRNA then increases dramatically at 148 h p.i. and 168 h p.i., when mature gametocytes and a mixture of gametocytes and unsporulated oocysts, respectively, are present in the ceca. Expression of Etgam56 mRNA was already very weakly detectable at 132 h p.i. and showed maximum expression between 144 h p.i. and 168 h p.i.

View larger version (73K):
[in this window]
[in a new window]
|
FIG. 7. Expression analysis of Etgam22. (A) RT-PCR with primers specific for Etgam22 and Etactin cDNAs. RNAs were isolated from sporulated oocysts, from the ceca of noninfected chickens (n.i.), or from the ceca of chickens infected with E. tenella for the indicated times. The reaction mixtures contained reverse transcriptase and RNA (lanes 1) or were performed in the absence of either the reverse transcriptase (lanes 2) or the RNA template (lanes 3). (B) RNA and protein were isolated from the same samples of oocysts and infected ceca at the indicated times, using Trizol. With these matched RNA and protein samples, Northern blot analyses of Etgam22 and Etgam56 mRNA expression and Western blot analysis with E2E5 were performed. (C) In vitro translation of EtGAM22. Products of coupled in vitro transcription and translation were separated by SDS-PAGE and transferred to a nitrocellulose membrane, and EtGAM22 was detected using the E2E5 antibody in Western blot analysis. The negative control reaction mix contained no plasmid DNA.
|
|
We also extracted proteins from the same tissue samples and analyzed the expression of proteins by using the antibody E2E5 (Fig. 7B). Weak expression of the approximately 60-kDa band could be detected as early as 132 h p.i. Bands of about 33 kDa and 25 kDa did not appear before 168 h p.i. and were still detectable in sporulated oocysts. In this context, it is noteworthy that in E. maxima, the ortholog EmGAM56 is cleaved into a 33-kDa polypeptide during oocyst formation (3). The 33-kDa protein in Fig. 7B is therefore assumed to represent the proteolytic fragment of EtGAM56. In accordance with our previous results, a 25-kDa band was also observed at 168 h p.i. However, we could not reproduce the weak 23-kDa band detected previously in purified unsporulated oocysts (26). Since in vitro translation of Etgam22 cDNA also produced a polypeptide of about 25 kDa (Fig. 7C), the 25-kDa band at 168 h p.i. most likely corresponds to EtGAM22. This view is also consistent with the fact that processing of EmGAM56 does not give rise to polypeptide fragments in the size range of 20 to 25 kDa (3).
 |
DISCUSSION
|
|---|
The WFBII in gametocytes provides essential components for the rigid and impermeable walls of oocysts, whose formation is a critical step in the life cycle of Eimeria parasites, which rely exclusively on the fecal/oral route for infection of new hosts. Using the monoclonal antibody E2E5, we describe the E. tenella GAM56 ortholog and confirm its proteolytic processing during oocyst wall formation. Moreover, we identify a novel type of small gametocyte-specific protein, EtGAM22, which also appears to be a structural component of the oocyst wall.
The genes encoding EtGAM22 and EtGAM56, identified here for E. tenella, and the previously characterized genes for the WFBII-localized proteins EmGAM56 and EmGAM82 in E. maxima have several characteristics in common. All of them are expressed specifically in gametocytes. Moreover, there is a remarkable absence of introns in these genes. Although Emgam56 was described to be a single-copy gene (5), the data presented here indicate the presence of two closely related genes, Etgam56 and Etgam59, in the genome of E. tenella. Etgam22 is the first multicopy gene described for Eimeria species, and its extraordinarily high copy number and the extremely conserved sequence between the copies suggest that Etgam22 has a particularly important role in oocyst wall formation. The high degree of conservation indicates that amplification of the Etgam22 gene was a very recent evolutionary event or that the sequences of the copies are frequently equalized by unequal crossover or gene conversion, which prevents sequence diversification, as previously described for multigene families, including rRNA (33) and histone (30, 32) genes. Apparently, such mechanisms do not act on gam56-like genes.
Among the apicomplexa, low-copy-number head-to-tail clusters of homologous intronless genes have been described for some of the T. gondii SAG genes that encode glycosylphosphatidylinositol-coupled surface antigens expressed by the invasive parasite stages (11, 21, 36). Sequence similarity and expression levels in different developmental stages vary widely between family members in the same cluster, and intergenic regions are usually not conserved, with the exception of those of SAG5B and SAG5C (36). In contrast, the intergenic regions in the Etgam22 gene cluster appear to be highly conserved, as far as can be deduced from the few sequenced repeats and the conservation of restriction sites, although we do not yet know whether all genes in the cluster are transcriptionally active. Expression of both Etgam56 and Etgam22 mRNAs is very high, since exposure times of Northern blots of as short as 2.5 h and 4 h, respectively, were sufficient to produce clearly detectable bands, despite the fact that the RNAs were not isolated from pure parasites but from infected ceca and would therefore contain large amounts of chicken RNA. It is therefore tempting to speculate that amplification of the Etgam22 gene copy number might be a mechanism to allow the production of large amounts of RNA within a very short period, as previously described for histone genes, which are highly expressed only during a short phase of the cell cycle (22). Despite the high level of Etgam22 mRNA, however, the protein band detected in Western blots is surprisingly quite faint. There are several possible explanations for this observation. First, the reactivity of the E2E5 antibody might be better for EtGAM56 than for EtGAM22, or extraction of EtGAM56 from the tissue might be easier than that of EtGAM22. Second, translation of Etgam22 mRNA might be inefficient, with only low levels of protein being produced. Third, translation of Etgam22 mRNA may be developmentally regulated and may not occur in macrogametocytes but in oocysts after fusion of gametes or during sporulation. This view is also supported by the fact that the EtGAM22 protein is not detectable at 144 h p.i., when transcript levels are maximal, although transcription starts at least 6 h earlier. However, the protein becomes detectable at 168 h p.i., when the first unsporulated oocysts appear in the cecum, as revealed by the beginning of proteolytic processing of EtGAM56.
At the protein level, similarity between EtGAM22 and EtGAM56 manifests itself as cross-reactivity with E2E5, as the presence of putative N-glycosylation sites, and as NH2-terminal signal peptides. The presence of a signal peptide and the fact that, in macrogametocytes, E2E5 exclusively recognizes WFBII, i.e., specialized regions within the rough ER (9), suggest that EtGAM22—like EmGAM56—is transported to the WFBII and participates in formation of the inner oocyst wall and/or the stieda body. For E. maxima, a GAM56-specific monoclonal antibody has been reported to recognize the WFBII in macrogametocytes, the oocyst wall, the outer sporocyst wall, and the stieda body (5). Since this pattern largely overlaps with the pattern of E2E5 labeling in E. tenella, a monoclonal antibody against EtGAM22 that does not cross-react with EtGAM56 will be necessary to evaluate the exact localization of EtGAM22.
Other His-rich proteins are known for parasites belonging to the apicomplexa, with the histidine-rich protein of Plasmodium lophurae (78% His residues) (12) displaying the most exceptional composition. However, the low sequence complexities of these proteins and EtGAM22 do not permit a phylogenetic analysis. Indeed, those His-rich proteins for which a function is known are surely not homologous to EtGAM22. For instance, the knob-associated histidine-rich protein of Plasmodium falciparum is involved in the interaction of parasite proteins in knobs on the erythrocyte surface with the host cell cytoskeleton (27, 29), whereas the histidine-rich protein 2 has been implicated in hemozoin formation of P. falciparum (28). In contrast, BLAST comparison of EtGAM22 with proteins predicted from the Toxoplasma gondii genome reveals the presence of at least five proteins with NH2-terminal signal peptides which are relatively rich in proline and histidine and have lengths in the range of 117 to 269 amino acids. Although there is not yet anything known about the function or developmental expression pattern of these proteins, it is tempting to speculate that some of them represent extracellular structural proteins, such as many proline- or hydroxyproline-rich glycoproteins in plant cell walls (15, 16) or histidine-rich proteins in Hydra nematocysts (17). Cross-linking of EmGAM56- and EmGAM82-derived peptides via dopamine has been shown in the oocyst wall (3), and His-rich proteins such as EtGAM22 might also be involved in stabilizing extracellular structures via cross-links between His and catechols, as described for insect cuticles (8, 14, 43).
The in vitro excystation inhibition assay presented here shows that the antibody E2E5 can significantly interfere with parasite development. Remarkably, vaccination with a preparation of native gametocyte antigens enriched for GAM56, GAM82, and GAM230, which are all involved in wall forming in E. maxima, has been shown to convey at least partial protection against homologous challenge (25, 39, 46). Since EtGAM22 represents a new family of oocyst wall proteins, it might be a useful supplement to a protective gametocyte-specific cocktail vaccine.
 |
ACKNOWLEDGMENTS
|
|---|
We thank Carsten Angenendt for valuable technical assistance.
Genomic data were provided by The Institute for Genomic Research (supported by NIH grant AI05093) and by the Sanger Center (Wellcome Trust). Expressed sequence tag sequences were generated by Washington University (NIH grant 1R01AI045806-01A1).
 |
FOOTNOTES
|
|---|
* Corresponding author. Mailing address: Division of Molecular Parasitology, Heinrich-Heine-University, Universitätsstr. 1, 40225 Düsseldorf, Germany. Phone: 49-211-8114733. Fax: 49-211-8114734. E-mail: kruecken{at}uni-duesseldorf.de 
Published ahead of print on 14 December 2007. 
 |
REFERENCES
|
|---|
- Belli, S. I., M. Lee, P. Thebo, M. G. Wallach, B. Schwartsburd, and N. C. Smith. 2002. Biochemical characterisation of the 56 and 82 kDa immunodominant gametocyte antigens from Eimeria maxima. Int. J. Parasitol. 32:805-816.[CrossRef][Medline]
- Belli, S. I., K. Mai, C. D. Skene, M. T. Gleeson, D. M. Witcombe, M. Katrib, A. Finger, M. G. Wallach, and N. C. Smith. 2004. Characterisation of the antigenic and immunogenic properties of bacterially expressed, sexual stage antigens of the coccidian parasite Eimeria maxima. Vaccine 22:4316-4325.[CrossRef][Medline]
- Belli, S. I., M. G. Wallach, C. Luxford, M. J. Davies, and N. C. Smith. 2003. Roles of tyrosine-rich precursor glycoproteins and dityrosine- and 3,4-dihydroxyphenylalanine-mediated protein cross-linking in development of the oocyst wall in the coccidian parasite Eimeria maxima. Eukaryot. Cell 2:456-464.[Abstract/Free Full Text]
- Belli, S. I., M. G. Wallach, and N. C. Smith. 2003. Cloning and characterization of the 82 kDa tyrosine-rich sexual stage glycoprotein, GAM82, and its role in oocyst wall formation in the apicomplexan parasite Eimeria maxima. Gene 307:201-212.[CrossRef][Medline]
- Belli, S. I., D. Witcombe, M. G. Wallach, and N. C. Smith. 2002. Functional genomics of gam56: characterisation of the role of a 56 kilodalton sexual stage antigen in oocyst wall formation in Eimeria maxima. Int. J. Parasitol. 32:1727-1737.[CrossRef][Medline]
- Bendtsen, J. D., H. Nielsen, G. von Heijne, and S. Brunak. 2004. Improved prediction of signal peptides: SignalP 3.0. J. Mol. Biol. 340:783-795.[CrossRef][Medline]
- Blin, N., and D. W. Stafford. 1976. A general method for isolation of high molecular weight DNA from eukaryotes. Nucleic Acids Res. 3:2303-2308.[Medline]
- Christensen, A. M., J. Schaefer, K. J. Kramer, T. D. Morgan, and T. L. Hopkins. 1991. Detection of cross-links in insect cuticle by redor NMR-spectroscopy. J. Am. Chem. Soc. 113:6799-6802.[CrossRef]
- Ferguson, D. J., S. I. Belli, N. C. Smith, and M. G. Wallach. 2003. The development of the macrogamete and oocyst wall in Eimeria maxima: immuno-light and electron microscopy. Int. J. Parasitol. 33:1329-1340.[CrossRef][Medline]
- Fetterer, R. H., and R. C. Barfield. 2003. Characterization of a developmentally regulated oocyst protein from Eimeria tenella. J. Parasitol. 89:553-564.[CrossRef][Medline]
- Hehl, A., T. Krieger, and J. C. Boothroyd. 1997. Identification and characterization of SRS1, a Toxoplasma gondii surface antigen upstream of and related to SAG1. Mol. Biochem. Parasitol. 89:271-282.[CrossRef][Medline]
- Irving, D. O., and G. A. Cross. 1986. Primary structure of the histidine-rich protein of Plasmodium lophurae. Nature 324:492.
- Julenius, K., A. Molgaard, R. Gupta, and S. Brunak. 2005. Prediction, conservation analysis, and structural characterization of mammalian mucin-type O-glycosylation sites. Glycobiology 15:153-164.[Abstract/Free Full Text]
- Kerwin, J. L., F. Turecek, R. D. Xu, K. J. Kramer, T. L. Hopkins, C. L. Gatlin, and J. R. Yates. 1999. Mass spectrometric analysis of catechol-histidine adducts from insect cuticle. Anal. Biochem. 268:229-237.[CrossRef][Medline]
- Kieliszewski, M. J., and D. T. Lamport. 1994. Extensin: repetitive motifs, functional sites, post-translational codes, and phylogeny. Plant J. 5:157-172.[CrossRef][Medline]
- Kieliszewski, M. J., and E. Shpak. 2001. Synthetic genes for the elucidation of glycosylation codes for arabinogalactan-proteins and other hydroxyproline-rich glycoproteins. Cell Mol. Life Sci. 58:1386-1398.[CrossRef][Medline]
- Koch, A. W., T. W. Holstein, C. Mala, E. Kurz, J. Engel, and C. N. David. 1998. Spinalin, a new glycine- and histidine-rich protein in spines of Hydra nematocysts. J. Cell Sci. 111:1545-1554.[Abstract]
- Krücken, J., R. M. Schroetel, I. U. Müller, N. Saïdani, P. Marinovski, W. P. Benten, O. Stamm, and F. Wunderlich. 2004. Comparative analysis of the human gimap gene cluster encoding a novel GTPase family. Gene 341:291-304.[CrossRef][Medline]
- Krücken, J., O. Stamm, H.-P. Schmitt-Wrede, A. Mincheva, P. Lichter, and F. Wunderlich. 1999. Spleen-specific expression of the malaria-inducible intronless mouse gene imap38. J. Biol. Chem. 274:24383-24391.[Abstract/Free Full Text]
- Laemmli, U. K. 1970. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227:680-685.[CrossRef][Medline]
- Lekutis, C., D. J. Ferguson, M. E. Grigg, M. Camps, and J. C. Boothroyd. 2001. Surface antigens of Toxoplasma gondii: variations on a theme. Int. J. Parasitol. 31:1285-1292.[CrossRef][Medline]
- Marzluff, W. F., P. Gongidi, K. R. Woods, J. Jin, and L. J. Maltais. 2002. The human and mouse replication-dependent histone genes. Genomics 80:487-498.[CrossRef][Medline]
- McDonald, V., and M. E. Rose. 1987. Eimeria tenella and E. necatrix: a third generation of schizogony is an obligatory part of the developmental cycle. J. Parasitol. 73:617-622.[CrossRef][Medline]
- Mehlhorn, H. 2005. Eimeria, p. 198-199. In H. Mehlhorn (ed.), Encyclopedic reference of parasitology. Biology, structure, function. Springer, Berlin, Germany.
- Michael, A. 2002. The practical use of a maternal vaccine against coccidiosis. World Poultry 19:24-26.
- Mouafo, A. N., A. Weck-Heimann, J. F. Dubremetz, and R. Entzeroth. 2002. Monoclonal antibodies specific for the two types of wall-forming bodies of Eimeria tenella macrogametes (Coccidia, Apicomplexa). Parasitol. Res. 88:217-224.[CrossRef][Medline]
- Oh, S. S., S. Voigt, D. Fisher, S. J. Yi, P. J. LeRoy, L. H. Derick, S. Liu, and A. H. Chishti. 2000. Plasmodium falciparum erythrocyte membrane protein 1 is anchored to the actin-spectrin junction and knob-associated histidine-rich protein in the erythrocyte skeleton. Mol. Biochem. Parasitol. 108:237-247.[CrossRef][Medline]
- Pandey, A. V., V. K. Babbarwal, J. N. Okoyeh, R. M. Joshi, S. K. Puri, R. L. Singh, and V. S. Chauhan. 2003. Hemozoin formation in malaria: a two-step process involving histidine-rich proteins and lipids. Biochem. Biophys. Res. Commun. 308:736-743.[CrossRef][Medline]
- Pei, X., X. An, X. Guo, M. Tarnawski, R. Coppel, and N. Mohandas. 2005. Structural and functional studies of interaction between Plasmodium falciparum knob-associated histidine-rich protein (KAHRP) and erythrocyte spectrin. J. Biol. Chem. 280:31166-31171.[Abstract/Free Full Text]
- Piontkivska, H., A. P. Rooney, and M. Nei. 2002. Purifying selection and birth-and-death evolution in the histone H4 gene family. Mol. Biol. Evol. 19:689-697.[Abstract/Free Full Text]
- Pittilo, R. M., and S. J. Ball. 1980. The ultrastructural development of the oocyst wall of Eimeria maxima. Parasitology 81:115-122.[Medline]
- Rooney, A. P., H. Piontkivska, and M. Nei. 2002. Molecular evolution of the nontandemly repeated genes of the histone 3 multigene family. Mol. Biol. Evol. 19:68-75.[Abstract/Free Full Text]
- Rooney, A. P., and T. J. Ward. 2005. Evolution of a large ribosomal RNA multigene family in filamentous fungi: birth and death of a concerted evolution paradigm. Proc. Natl. Acad. Sci. USA 102:5084-5089.[Abstract/Free Full Text]
- Ryley, J. F. 1973. Cytochemistry, physiology and biochemistry, p. 145-181. In D. M. Hammond and P. L. Long (ed.), The coccidia. University Park Press, London, United Kingdom.
- Scholtyseck, E., H. Mehlhorn, and D. M. Hammond. 1971. Fine structure of macrogametes and oocysts of Coccidia and related organisms. Z. Parasitenkd. 37:1-43.[CrossRef][Medline]
- Spano, F., I. Ricci, M. Di Cristina, A. Possenti, M. Tinti, N. Dendouga, S. Tomavo, and A. Crisanti. 2002. The SAG5 locus of Toxoplasma gondii encodes three novel proteins belonging to the SAG1 family of surface antigens. Int. J. Parasitol. 32:121-131.[CrossRef][Medline]
- Stotish, R. L., C. C. Wang, and M. Meyenhofer. 1978. Structure and composition of the oocyst wall of Eimeria tenella. J. Parasitol. 64:1074-1081.[CrossRef][Medline]
- Wallach, M. 1997. The importance of transmission-blocking immunity in the control of infections by apicomplexan parasites. Int. J. Parasitol. 27:1159-1167.[CrossRef][Medline]
- Wallach, M. 2002. The development of a novel vaccine against coccidiosis. World Poultry 19:24-26.
- Wallach, M. G., D. Mencher, S. Yarus, G. Pillemer, A. Halabi, and T. Pugatsch. 1989. Eimeria maxima: identification of gametocyte protein antigens. Exp. Parasitol. 68:49-56.[CrossRef][Medline]
- Williams, R. B., W. W. Carlyle, D. R. Bond, and I. A. Brown. 1999. The efficacy and economic benefits of Paracox, a live attenuated anticoccidial vaccine, in commercial trials with standard broiler chickens in the United Kingdom. Int. J. Parasitol. 29:341-355.[CrossRef][Medline]
- Wunderlich, F., M. A. Dkhil, L. I. Mehnert, J. V. Braun, M. El Khadragy, E. Borsch, D. Hermsen, W. P. Benten, K. Pfeffer, H. Mossmann, and J. Krücken. 2005. Testosterone responsiveness of spleen and liver in female lymphotoxin beta receptor-deficient mice resistant to blood-stage malaria. Microbes Infect. 7:399-409.[CrossRef][Medline]
- Xu, R. D., X. Huang, T. L. Hopkins, and K. J. Kramer. 1997. Catecholamine and histidyl protein cross-linked structures in sclerotized insect cuticle. Insect Biochem. Mol. Biol. 27:101-108.[CrossRef]
- Zdobnov, E. M., and R. Apweiler. 2001. InterProScan—an integration platform for the signature-recognition methods in InterPro. Bioinformatics 17:847-848.[Abstract/Free Full Text]
- Zhang, L., K. Jacobsson, K. Strom, M. Lindberg, and L. Frykberg. 1999. Staphylococcus aureus expresses a cell surface protein that binds both IgG and beta2-glycoprotein I. Microbiology 145:177-183.[Abstract]
- Ziomko, R., J. Karamon, T. Cencek, E. Gornowicz, A. Skoracki, and U. Ashash. 2005. Prevention of broiler chick coccidiosis using the inactivated subunit vaccine CoxAbic. Bull. Vet. Inst. Puawy 49:299-302.
Eukaryotic Cell, February 2008, p. 202-211, Vol. 7, No. 2
1535-9778/08/$08.00+0 doi:10.1128/EC.00292-07
Copyright © 2008, American Society for Microbiology. All Rights Reserved.